Lineage for d4uimd1 (4uim D:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761035Domain d4uimd1: 4uim D:1-107 [276587]
    Other proteins in same PDB: d4uima_, d4uimb2, d4uimc_, d4uimd2, d4uime_, d4uimf2, d4uimh_, d4uiml2
    automated match to d2v7ha1
    complexed with so4

Details for d4uimd1

PDB Entry: 4uim (more details), 2.7 Å

PDB Description: crystal structure of quinine-dependent fab 314.3
PDB Compounds: (D:) fab 314.3

SCOPe Domain Sequences for d4uimd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uimd1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps
rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleik

SCOPe Domain Coordinates for d4uimd1:

Click to download the PDB-style file with coordinates for d4uimd1.
(The format of our PDB-style files is described here.)

Timeline for d4uimd1: