SCOPe 2.05: Domain d4rysa_: 4rys A:

Lineage for d4rysa_ (4rys A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Cfp marker [TaxId:141850] [276575] (1 PDB entry)

8. Domain d4rysa_: 4rys A: [276576]
   automated match to d2h9wa_
   complexed with gol

Details for d4rysa_

PDB Entry: 4rys, 1.18 Å

PDB Description: crystal structure of the green fluorescent rotein nowgfp (the variant of cyan cerulean) at ph 4.8

PDB Compounds: (A:) nowGFP

SCOPe Domain Sequences for d4rysa_:

Sequence; same for both SEQRES and ATOM records:

>d4rysa_ d.22.1.1 (A:) automated matches {Cfp marker [TaxId: 141850]}
svskgeklftgvvpilveldgdvnghkfsvsgegegdatygkmslkficttgklpvpwpt
lkttltwgmqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtl
vnrielkgvdfkedgnilghkleynaisgnanitadkqkngikayftirhdvedgsvlla
dhyqqntpigdgpvllpdnhylstqskqskdpnekrdhmvllefvtaagipl

Timeline for d4rysa_:

• d4rysa_ is new in SCOPe 2.05-stable
  
• d4rysa_ is called d4rysa1 in SCOPe 2.06
  
• d4rysa_ appears in the current release, SCOPe 2.08, called d4rysa1