Lineage for d1b9xa_ (1b9x A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2075799Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2075800Family b.69.4.1: WD40-repeat [50979] (13 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2075823Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)
  7. 2075824Species Cow (Bos taurus) [TaxId:9913] [50981] (29 PDB entries)
  8. 2075845Domain d1b9xa_: 1b9x A: [27657]
    Other proteins in same PDB: d1b9xb_, d1b9xc_
    complexed with gd

Details for d1b9xa_

PDB Entry: 1b9x (more details), 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin
PDB Compounds: (A:) protein (transducin)

SCOPe Domain Sequences for d1b9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9xa_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}
mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOPe Domain Coordinates for d1b9xa_:

Click to download the PDB-style file with coordinates for d1b9xa_.
(The format of our PDB-style files is described here.)

Timeline for d1b9xa_: