Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (23 PDB entries) |
Domain d5d9hb_: 5d9h B: [276568] automated match to d4lg4c_ complexed with atp, mg, so4 |
PDB Entry: 5d9h (more details), 3.1 Å
SCOPe Domain Sequences for d5d9hb_:
Sequence, based on SEQRES records: (download)
>d5d9hb_ d.144.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avgwpicrdayelqevigsgatavvqaalckprqervaikrinlekcqtsmdellkeiqa msqcshpnvvtyytsfvvkdelwlvmkllsggsmldiikyivnrgehkngvleeaiiati lkevlegldylhrngqihrdlkagnillgedgsvqiadfgvsaflatggdvtrnkvrktf vgtpcwmapevmeqvrgydfkadmwsfgitaielatgaapyhkyppmkvlmltlqndppt letgvedkemmkkygksfrkllslclqkdpskrptaaellkckffqkaknreyliekllt
>d5d9hb_ d.144.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avgwpicrdayelqevigsgatavvqaalckprqervaikrinlekcqtsmdellkeiqa msqcshpnvvtyytsfvvkdelwlvmkllsggsmldiikyivnrgehkngvleeaiiati lkevlegldylhrngqihrdlkagnillgedgsvqiadfgvsaflatggdvtrngtpcwm apevmeqvrgydfkadmwsfgitaielatgaapyhkyppmkvlmltlqndpptletgved kemmkkygksfrkllslclqkdpskrptaaellkckffqkaknreyliekllt
Timeline for d5d9hb_: