Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
Protein automated matches [226902] (9 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [276304] (3 PDB entries) |
Domain d5d9ua2: 5d9u A:137-305 [276559] Other proteins in same PDB: d5d9ua1, d5d9ub1 automated match to d3mcqa2 complexed with adp, mg, na, tpp |
PDB Entry: 5d9u (more details), 1.9 Å
SCOPe Domain Sequences for d5d9ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d9ua2 d.139.1.0 (A:137-305) automated matches {Acinetobacter baumannii [TaxId: 470]} tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhfa
Timeline for d5d9ua2: