SCOPe 2.08: Domain d5cc8a2: 5cc8 A:137-298

Lineage for d5cc8a2 (5cc8 A:137-298)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:525243] [276534] (1 PDB entry)

8. Domain d5cc8a2: 5cc8 A:137-298 [276537]
   Other proteins in same PDB: d5cc8a1, d5cc8b1
   automated match to d3mcqa2
   complexed with anp, cl, k, mg

Details for d5cc8a2

PDB Entry: 5cc8, 1.75 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with amppnp

PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5cc8a2:

Sequence; same for both SEQRES and ATOM records:

>d5cc8a2 d.139.1.0 (A:137-298) automated matches {Acinetobacter baumannii [TaxId: 525243]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqi

Timeline for d5cc8a2:

• d5cc8a2 first appeared in SCOPe 2.05
  
• d5cc8a2 appears in SCOPe 2.07