SCOPe 2.05: Domain d5c0rl1: 5c0r L:1-107

Lineage for d5c0rl1 (5c0r L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d5c0rl1: 5c0r L:1-107 [276528]
   Other proteins in same PDB: d5c0rl2
   automated match to d1a5fl1
   complexed with nag

Details for d5c0rl1

PDB Entry: 5c0r, 3.19 Å

PDB Description: crystal structure of a generation 3 influenza hemagglutinin stabilized stem complexed with the broadly neutralizing antibody c179

PDB Compounds: (L:) C179 Fab light chain

SCOPe Domain Sequences for d5c0rl1:

Sequence; same for both SEQRES and ATOM records:

>d5c0rl1 b.1.1.0 (L:1-107) automated matches {Mus musculus [TaxId: 10090]}
diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtkleik

Timeline for d5c0rl1:

• d5c0rl1 is new in SCOPe 2.05-stable
  
• d5c0rl1 appears in SCOPe 2.06
  
• d5c0rl1 appears in the current release, SCOPe 2.07