Lineage for d5bxbc_ (5bxb C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903467Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1903468Protein automated matches [190710] (3 species)
    not a true protein
  7. 1903469Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries)
  8. 1903513Domain d5bxbc_: 5bxb C: [276505]
    automated match to d3kvta_

Details for d5bxbc_

PDB Entry: 5bxb (more details), 2.17 Å

PDB Description: crystal structure of pentameric kctd1 btb domain form 1
PDB Compounds: (C:) BTB/POZ domain-containing protein KCTD1

SCOPe Domain Sequences for d5bxbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxbc_ d.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snanapvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfr
yilnflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdr

SCOPe Domain Coordinates for d5bxbc_:

Click to download the PDB-style file with coordinates for d5bxbc_.
(The format of our PDB-style files is described here.)

Timeline for d5bxbc_: