Lineage for d5abia_ (5abi A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204134Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2204135Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2204136Family d.86.1.1: Translation initiation factor eIF4e [55419] (2 proteins)
    automatically mapped to Pfam PF01652
  6. 2204212Protein automated matches [276484] (1 species)
    not a true protein
  7. 2204213Species Human (Homo sapiens) [TaxId:9606] [276485] (1 PDB entry)
  8. 2204214Domain d5abia_: 5abi A: [276486]
    automated match to d1ipca_
    complexed with gol

Details for d5abia_

PDB Entry: 5abi (more details), 1.97 Å

PDB Description: identification of a water-bridge mediated recognition module at the mrna cap-binding interface of eif4e
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5abia_:

Sequence, based on SEQRES records: (download)

>d5abia_ d.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
slfkdgiepmwedaanarggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
avvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgstt
knrfvv

Sequence, based on observed residues (ATOM records): (download)

>d5abia_ d.86.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
slfkdgiepmwedaanarggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
avvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatktknrf
vv

SCOPe Domain Coordinates for d5abia_:

Click to download the PDB-style file with coordinates for d5abia_.
(The format of our PDB-style files is described here.)

Timeline for d5abia_: