Lineage for d1gotb_ (1got B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62854Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 62890Superfamily b.69.4: Trp-Asp repeat (WD-repeat) [50978] (1 family) (S)
  5. 62891Family b.69.4.1: Trp-Asp repeat (WD-repeat) [50979] (2 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 62892Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (2 species)
  7. 62893Species Cow (Bos taurus) [TaxId:9913] [50981] (8 PDB entries)
  8. 62904Domain d1gotb_: 1got B: [27648]
    Other proteins in same PDB: d1gota1, d1gota2, d1gotg_

Details for d1gotb_

PDB Entry: 1got (more details), 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

SCOP Domain Sequences for d1gotb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gotb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)}
seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
adragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOP Domain Coordinates for d1gotb_:

Click to download the PDB-style file with coordinates for d1gotb_.
(The format of our PDB-style files is described here.)

Timeline for d1gotb_: