Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
Protein automated matches [190708] (10 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [276473] (2 PDB entries) |
Domain d5abxa_: 5abx A: [276477] automated match to d1l8bb_ complexed with cl, mgp, zn |
PDB Entry: 5abx (more details), 1.66 Å
SCOPe Domain Sequences for d5abxa_:
Sequence, based on SEQRES records: (download)
>d5abxa_ d.86.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf kegikpmwedvnnvqggrwlvvvdkqklqrrtqlldhywlellmaivgeqfdeygdyicg avvnvrqkgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssartsstv kpricl
>d5abxa_ d.86.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf kegikpmwedvnnvqggrwlvvvdtqlldhywlellmaivgeqfdeygdyicgavvnvrq kgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssakpricl
Timeline for d5abxa_: