SCOPe 2.05: Domain d5a43d_: 5a43 D:

Lineage for d5a43d_ (5a43 D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (36 PDB entries)

8. Domain d5a43d_: 5a43 D: [276467]
   automated match to d3k2mc_
   complexed with dmu, f, na

Details for d5a43d_

PDB Entry: 5a43, 2.58 Å

PDB Description: crystal structure of a dual topology fluoride ion channel.

PDB Compounds: (D:) monobodies

SCOPe Domain Sequences for d5a43d_:

Sequence; same for both SEQRES and ATOM records:

>d5a43d_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstati
sglkpgvdytitvytmyysysdlysysspisinyrt

Timeline for d5a43d_:

• d5a43d_ is new in SCOPe 2.05-stable
  
• d5a43d_ appears in SCOPe 2.06
  
• d5a43d_ appears in the current release, SCOPe 2.08