SCOPe 2.05: Domain d4zzda_: 4zzd A:

Lineage for d4zzda_ (4zzd A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:416870] [188710] (4 PDB entries)

8. Domain d4zzda_: 4zzd A: [276463]
   automated match to d3f8fa_
   complexed with rbf

Details for d4zzda_

PDB Entry: 4zzd, 2.35 Å

PDB Description: crystal structure of multidrug resistance regulator lmrr bound to riboflavin

PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d4zzda_:

Sequence, based on SEQRES records:

>d4zzda_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlea

Sequence, based on observed residues (ATOM records):

>d4zzda_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdrkyyrlteighenmrlafeswsrvdkiienlea

Timeline for d4zzda_:

• d4zzda_ is new in SCOPe 2.05-stable
  
• d4zzda_ appears in SCOPe 2.06
  
• d4zzda_ appears in the current release, SCOPe 2.08