Lineage for d1qnid2 (1qni D:10-450)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17159Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 17180Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 17181Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (1 protein)
  6. 17182Protein Nitrous oxide reductase, N-terminal domain [50976] (1 species)
  7. 17183Species Pseudomonas nautica [TaxId:2743] [50977] (1 PDB entry)
  8. 17187Domain d1qnid2: 1qni D:10-450 [27645]
    Other proteins in same PDB: d1qnia1, d1qnib1, d1qnic1, d1qnid1, d1qnie1, d1qnif1

Details for d1qnid2

PDB Entry: 1qni (more details), 2.4 Å

PDB Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution

SCOP Domain Sequences for d1qnid2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnid2 b.69.3.1 (D:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica}
ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
gptyaephdcilvrrdqiktk

SCOP Domain Coordinates for d1qnid2:

Click to download the PDB-style file with coordinates for d1qnid2.
(The format of our PDB-style files is described here.)

Timeline for d1qnid2: