Lineage for d4z70a_ (4z70 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1789893Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 1790027Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 1790028Protein automated matches [190523] (11 species)
    not a true protein
  7. 1790075Species Mycobacterium tuberculosis [TaxId:83332] [225097] (6 PDB entries)
  8. 1790080Domain d4z70a_: 4z70 A: [276431]
    automated match to d1wcfa_
    complexed with ca

Details for d4z70a_

PDB Entry: 4z70 (more details), 1.95 Å

PDB Description: crystal structure of inorganic pyrophosphatase from mycobacterium tuberculosis in complex with ca ions
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d4z70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z70a_ b.40.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
amqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldal
vllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldai
khffvhykdlepgkfvkaadwvdraeaeaevqrsverfka

SCOPe Domain Coordinates for d4z70a_:

Click to download the PDB-style file with coordinates for d4z70a_.
(The format of our PDB-style files is described here.)

Timeline for d4z70a_: