Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.0: automated matches [191399] (1 protein) not a true family |
Protein automated matches [190523] (12 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225097] (8 PDB entries) |
Domain d4z71a1: 4z71 A:1-159 [276428] Other proteins in same PDB: d4z71a2, d4z71b2, d4z71c2 automated match to d1wcfa_ complexed with mg |
PDB Entry: 4z71 (more details), 1.85 Å
SCOPe Domain Sequences for d4z71a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z71a1 b.40.5.0 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldalv llpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldaik hffvhykdlepgkfvkaadwvdraeaeaevqrsverfka
Timeline for d4z71a1:
View in 3D Domains from other chains: (mouse over for more information) d4z71b1, d4z71b2, d4z71c1, d4z71c2 |