SCOPe 2.07: Domain d4ygaf_: 4yga F:

Lineage for d4ygaf_ (4yga F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d4ygaf_: 4yga F: [276401]
   automated match to d1mqkh_
   complexed with ca

Details for d4ygaf_

PDB Entry: 4yga, 2.94 Å

PDB Description: cdpk1, from toxoplasma gondii, bound to inhibitory vhh-1b7

PDB Compounds: (F:) vhh-1b7

SCOPe Domain Sequences for d4ygaf_:

Sequence; same for both SEQRES and ATOM records:

>d4ygaf_ b.1.1.0 (F:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlvetggglvqpgeslrlscvasgftldhsavgwfrqvpgkerekllcinangvsldy
adsikgrftisrdnakntvylqmndlkpedtatyscaatrefcsayvflyehwgqgtqvt
vss

Timeline for d4ygaf_:

• d4ygaf_ first appeared in SCOPe 2.05
  
• d4ygaf_ appears in SCOPe 2.06
  
• d4ygaf_ appears in the current release, SCOPe 2.08