Lineage for d4tr9d_ (4tr9 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822946Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1822947Protein automated matches [190115] (63 species)
    not a true protein
  7. 1823329Species Plasmodium falciparum [TaxId:36329] [276356] (1 PDB entry)
  8. 1823333Domain d4tr9d_: 4tr9 D: [276359]
    automated match to d3kx6a_
    complexed with 38d

Details for d4tr9d_

PDB Entry: 4tr9 (more details), 2.11 Å

PDB Description: ternary co-crystal structure of fructose-bisphosphate aldolase from plasmodium falciparum in complex with trap and a small molecule inhibitor
PDB Compounds: (D:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d4tr9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tr9d_ c.1.10.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
eymnapkklpadvaeelattaqklvqagkgilaadestqtikkrfdniklentienrasy
rdllfgtkglgkfisgailfeetlfqkneagvpmvnllhneniipgikvdkglvnipctd
eekstqgldglaerckeyykagarfakwrtvlvidtakgkptdlsihetawglaryasic
qqnrlvpivepeiladgphsievcavvtqkvlscvfkalqengvllegallkpnmvtagy
ectaktttqdvgfltvrtlrrtvppalpgvvflsggqseeeasvnlnsinalgphpwalt
fsygralqasvlntwqgkkenvakarevllqraeanslatygkykgg

SCOPe Domain Coordinates for d4tr9d_:

Click to download the PDB-style file with coordinates for d4tr9d_.
(The format of our PDB-style files is described here.)

Timeline for d4tr9d_: