SCOPe 2.05: Domain d4tr9b_: 4tr9 B:

Lineage for d4tr9b_ (4tr9 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [276356] (1 PDB entry)

8. Domain d4tr9b_: 4tr9 B: [276358]
   automated match to d3kx6a_
   complexed with 38d

Details for d4tr9b_

PDB Entry: 4tr9, 2.11 Å

PDB Description: ternary co-crystal structure of fructose-bisphosphate aldolase from plasmodium falciparum in complex with trap and a small molecule inhibitor

PDB Compounds: (B:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d4tr9b_:

Sequence; same for both SEQRES and ATOM records:

>d4tr9b_ c.1.10.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
eymnapkklpadvaeelattaqklvqagkgilaadestqtikkrfdniklentienrasy
rdllfgtkglgkfisgailfeetlfqkneagvpmvnllhneniipgikvdkglvnipctd
eekstqgldglaerckeyykagarfakwrtvlvidtakgkptdlsihetawglaryasic
qqnrlvpivepeiladgphsievcavvtqkvlscvfkalqengvllegallkpnmvtagy
ectaktttqdvgfltvrtlrrtvppalpgvvflsggqseeeasvnlnsinalgphpwalt
fsygralqasvlntwqgkkenvakarevllqraeanslatygkykgg

Timeline for d4tr9b_:

• d4tr9b_ is new in SCOPe 2.05-stable
  
• d4tr9b_ appears in SCOPe 2.06
  
• d4tr9b_ appears in the current release, SCOPe 2.08