Lineage for d4rafa1 (4raf A:2-296)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564047Fold d.219: PP2C-like [81607] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; antiparallel beta sheets
  4. 2564048Superfamily d.219.1: PP2C-like [81606] (2 families) (S)
    contain binuclear metal (Mn) centre
  5. 2564049Family d.219.1.1: PP2C-like [81605] (3 proteins)
    Pfam PF00481
  6. 2564057Protein automated matches [232201] (1 species)
    not a true protein
  7. 2564058Species Human (Homo sapiens) [TaxId:9606] [232202] (8 PDB entries)
  8. 2564066Domain d4rafa1: 4raf A:2-296 [276343]
    Other proteins in same PDB: d4rafa2
    automated match to d1a6qa2
    complexed with mn

Details for d4rafa1

PDB Entry: 4raf (more details), 2 Å

PDB Description: crystal structure of pp2ca-d38a
PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d4rafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rafa1 d.219.1.1 (A:2-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gafldkpkmekhnaqgqgnglryglssmqgwrvemeaahtaviglpsgleswsffavydg
hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg
adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs
vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi
wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk

SCOPe Domain Coordinates for d4rafa1:

Click to download the PDB-style file with coordinates for d4rafa1.
(The format of our PDB-style files is described here.)

Timeline for d4rafa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rafa2