Class g: Small proteins [56992] (92 folds) |
Fold g.20: Blood coagulation inhibitor (disintegrin) [57551] (1 superfamily) small disulfide-rich |
Superfamily g.20.1: Blood coagulation inhibitor (disintegrin) [57552] (2 families) automatically mapped to Pfam PF00200 |
Family g.20.1.1: Blood coagulation inhibitor (disintegrin) [57553] (7 proteins) |
Protein Kistrin (rhodostomin) [57558] (1 species) |
Species Agkistrodon rhodostoma [TaxId:8717] [57559] (15 PDB entries) Uniprot P30403 408-475 |
Domain d4r5ub_: 4r5u B: [276333] automated match to d1n4ya_ mutant |
PDB Entry: 4r5u (more details), 1.81 Å
SCOPe Domain Sequences for d4r5ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r5ub_ g.20.1.1 (B:) Kistrin (rhodostomin) {Agkistrodon rhodostoma [TaxId: 8717]} cdcsspenpccdaatcklrpgaqcgeglcceqckfsragkiceiprgdmpddrctgqsad cpry
Timeline for d4r5ub_: