Lineage for d4r5ub_ (4r5u B:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964049Fold g.20: Blood coagulation inhibitor (disintegrin) [57551] (1 superfamily)
    small disulfide-rich
  4. 1964050Superfamily g.20.1: Blood coagulation inhibitor (disintegrin) [57552] (2 families) (S)
    automatically mapped to Pfam PF00200
  5. 1964051Family g.20.1.1: Blood coagulation inhibitor (disintegrin) [57553] (7 proteins)
  6. 1964060Protein Kistrin (rhodostomin) [57558] (1 species)
  7. 1964061Species Agkistrodon rhodostoma [TaxId:8717] [57559] (15 PDB entries)
    Uniprot P30403 408-475
  8. 1964072Domain d4r5ub_: 4r5u B: [276333]
    automated match to d1n4ya_
    mutant

Details for d4r5ub_

PDB Entry: 4r5u (more details), 1.81 Å

PDB Description: crystal structure of rhodostomin r46e mutant
PDB Compounds: (B:) Disintegrin rhodostomin

SCOPe Domain Sequences for d4r5ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r5ub_ g.20.1.1 (B:) Kistrin (rhodostomin) {Agkistrodon rhodostoma [TaxId: 8717]}
cdcsspenpccdaatcklrpgaqcgeglcceqckfsragkiceiprgdmpddrctgqsad
cpry

SCOPe Domain Coordinates for d4r5ub_:

Click to download the PDB-style file with coordinates for d4r5ub_.
(The format of our PDB-style files is described here.)

Timeline for d4r5ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4r5ua_