SCOPe 2.06: Domain d1goha3: 1goh A:151-537

Lineage for d1goha3 (1goh A:151-537)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (2 families)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein Galactose oxidase, central domain [50967] (3 species)
   N-terminal domain is a jelly-roll sandwich
   C-terminal domain is Immunoglobulin-like

7. Species Dactylium dendroides [TaxId:5132] [50968] (4 PDB entries)
   Uniprot Q01745 42-680

8. Domain d1goha3: 1goh A:151-537 [27633]
   Other proteins in same PDB: d1goha1, d1goha2
   complexed with na

Details for d1goha3

PDB Entry: 1goh, 2.2 Å

PDB Description: novel thioether bond revealed by a 1.7 angstroms crystal structure of galactose oxidase

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d1goha3:

Sequence; same for both SEQRES and ATOM records:

>d1goha3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Dactylium dendroides [TaxId: 5132]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyr
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgipfedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylynsn

Timeline for d1goha3:

• d1goha3 first appeared (with stable ids) in SCOP 1.55, called d1goh_3
  
• d1goha3 appears in SCOPe 2.05
  
• d1goha3 appears in SCOPe 2.07
  
• d1goha3 appears in the current release, SCOPe 2.08