Lineage for d5d3da2 (5d3d A:226-326)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179910Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2179911Protein automated matches [226841] (5 species)
    not a true protein
  7. 2179939Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries)
  8. 2179948Domain d5d3da2: 5d3d A:226-326 [276229]
    Other proteins in same PDB: d5d3da1, d5d3db1, d5d3db3
    automated match to d4rcob2
    complexed with cl, gol, na, scn

Details for d5d3da2

PDB Entry: 5d3d (more details), 1.94 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 3
PDB Compounds: (A:) Staphylococcal Superantigen-Like protein 3

SCOPe Domain Sequences for d5d3da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d3da2 d.15.6.0 (A:226-326) automated matches {Staphylococcus aureus [TaxId: 93061]}
kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt
ivikmknggkytfelhkklqehrmadvidgtnidnievnik

SCOPe Domain Coordinates for d5d3da2:

Click to download the PDB-style file with coordinates for d5d3da2.
(The format of our PDB-style files is described here.)

Timeline for d5d3da2: