Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries) |
Domain d5d3da2: 5d3d A:226-326 [276229] Other proteins in same PDB: d5d3da1, d5d3db1, d5d3db3 automated match to d4rcob2 complexed with cl, gol, na, scn |
PDB Entry: 5d3d (more details), 1.94 Å
SCOPe Domain Sequences for d5d3da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d3da2 d.15.6.0 (A:226-326) automated matches {Staphylococcus aureus [TaxId: 93061]} kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt ivikmknggkytfelhkklqehrmadvidgtnidnievnik
Timeline for d5d3da2: