Class a: All alpha proteins [46456] (290 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein automated matches [190929] (5 species) not a true protein |
Species Influenza A virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId:1129345] [276215] (1 PDB entry) |
Domain d5bxzb_: 5bxz B: [276218] automated match to d2z0ac_ |
PDB Entry: 5bxz (more details), 2.6 Å
SCOPe Domain Sequences for d5bxzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxzb_ a.16.1.1 (B:) automated matches {Influenza A virus (a/little yellow-shouldered bat/guatemala/153/2009(h17n10)) [TaxId: 1129345]} epnpttiafqvdcylwhlkktlsmmgevdapfedrlrreqkalkgrsmtlgidiqsatqe gyykiksite
Timeline for d5bxzb_: