Lineage for d4rexa_ (4rex A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804793Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1804794Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1804795Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1804888Protein automated matches [192459] (3 species)
    not a true protein
  7. 1804891Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)
  8. 1804892Domain d4rexa_: 4rex A: [276174]
    automated match to d1jmqa_
    complexed with so4

Details for d4rexa_

PDB Entry: 4rex (more details), 1.6 Å

PDB Description: crystal structure of the first ww domain of human yap2 isoform
PDB Compounds: (A:) Yorkie homolog

SCOPe Domain Sequences for d4rexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rexa_ b.72.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gamgfeipddvplpagwemaktssgqryflnhidqtttwqdprkamls

SCOPe Domain Coordinates for d4rexa_:

Click to download the PDB-style file with coordinates for d4rexa_.
(The format of our PDB-style files is described here.)

Timeline for d4rexa_: