Lineage for d5cvxa_ (5cvx A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737334Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1737335Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1737400Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 1737401Protein automated matches [191007] (5 species)
    not a true protein
  7. 1737413Species Spiroplasma melliferum [TaxId:570509] [260909] (2 PDB entries)
  8. 1737415Domain d5cvxa_: 5cvx A: [276146]
    automated match to d4n1va_

Details for d5cvxa_

PDB Entry: 5cvx (more details), 1.36 Å

PDB Description: structure of dna-binding protein hu from micoplasma spiroplasma melliferum
PDB Compounds: (A:) DNA-binding protein

SCOPe Domain Sequences for d5cvxa_:

Sequence, based on SEQRES records: (download)

>d5cvxa_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]}
ghmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
ardgrnpstgetikipasksakfkagkqlktdlnn

Sequence, based on observed residues (ATOM records): (download)

>d5cvxa_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]}
ghmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
ardgrntgetikipasksakfkagkqlktdlnn

SCOPe Domain Coordinates for d5cvxa_:

Click to download the PDB-style file with coordinates for d5cvxa_.
(The format of our PDB-style files is described here.)

Timeline for d5cvxa_:

  • d5cvxa_ is new in SCOPe 2.05-stable
  • d5cvxa_ last appears in SCOPe 2.06, called d5cvxa1