Class a: All alpha proteins [46456] (286 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
Protein automated matches [191007] (5 species) not a true protein |
Species Spiroplasma melliferum [TaxId:570509] [260909] (2 PDB entries) |
Domain d5cvxa_: 5cvx A: [276146] automated match to d4n1va_ |
PDB Entry: 5cvx (more details), 1.36 Å
SCOPe Domain Sequences for d5cvxa_:
Sequence, based on SEQRES records: (download)
>d5cvxa_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]} ghmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera ardgrnpstgetikipasksakfkagkqlktdlnn
>d5cvxa_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]} ghmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera ardgrntgetikipasksakfkagkqlktdlnn
Timeline for d5cvxa_: