SCOPe 2.06: Domain d5cy4d1: 5cy4 D:1-183

Lineage for d5cy4d1 (5cy4 D:1-183)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry)

8. Domain d5cy4d1: 5cy4 D:1-183 [276141]
   Other proteins in same PDB: d5cy4a2, d5cy4c2, d5cy4d2, d5cy4e2
   automated match to d2gbza_
   complexed with ca, edo

Details for d5cy4d1

PDB Entry: 5cy4, 2.25 Å

PDB Description: crystal structure of an oligoribonuclease from acinetobacter baumannii

PDB Compounds: (D:) Oligoribonuclease

SCOPe Domain Sequences for d5cy4d1:

Sequence; same for both SEQRES and ATOM records:

>d5cy4d1 c.55.3.0 (D:1-183) automated matches {Acinetobacter baumannii [TaxId: 470]}
msstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnamd
ewntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhrl
mpeleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyff
imn

Timeline for d5cy4d1:

• d5cy4d1 first appeared in SCOPe 2.05, called d5cy4d_
  
• d5cy4d1 appears in SCOPe 2.07
  
• d5cy4d1 appears in the current release, SCOPe 2.08