SCOPe 2.05: Domain d5cy4d_: 5cy4 D:

Lineage for d5cy4d_ (5cy4 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry)

8. Domain d5cy4d_: 5cy4 D: [276141]
   automated match to d2gbza_
   complexed with ca, edo

Details for d5cy4d_

PDB Entry: 5cy4, 2.25 Å

PDB Description: crystal structure of an oligoribonuclease from acinetobacter baumannii

PDB Compounds: (D:) Oligoribonuclease

SCOPe Domain Sequences for d5cy4d_:

Sequence; same for both SEQRES and ATOM records:

>d5cy4d_ c.55.3.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hmsstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnam
dewntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhr
lmpeleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyf
fimn

Timeline for d5cy4d_:

• d5cy4d_ is new in SCOPe 2.05-stable
  
• d5cy4d_ is called d5cy4d1 in SCOPe 2.06
  
• d5cy4d_ appears in the current release, SCOPe 2.08, called d5cy4d1