Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [276138] (1 PDB entry) |
Domain d5cy4d_: 5cy4 D: [276141] automated match to d2gbza_ complexed with ca, edo |
PDB Entry: 5cy4 (more details), 2.25 Å
SCOPe Domain Sequences for d5cy4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cy4d_ c.55.3.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 470]} hmsstlntrliwidlemtgldtdndqiieiatiitddhlnvlaegpvlaihqpdrilnam dewntrqhgqsgliervrrskltardaelqtleflkkwvnpkvspmcgnsicqdrrflhr lmpeleqyfhyrnldvstvkelskrwrpeimsglkknashlamddirdsiselkyyreyf fimn
Timeline for d5cy4d_: