Lineage for d5cqbb_ (5cqb B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882831Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 1882832Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 1882833Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
    automatically mapped to Pfam PF01255
  6. 1882870Protein automated matches [190121] (4 species)
    not a true protein
  7. 1882889Species Escherichia coli [TaxId:83333] [276134] (1 PDB entry)
  8. 1882891Domain d5cqbb_: 5cqb B: [276136]
    automated match to d1x07a_
    complexed with pge

Details for d5cqbb_

PDB Entry: 5cqb (more details), 2.2 Å

PDB Description: crystal structure of e. coli undecaprenyl pyrophosphate synthase
PDB Compounds: (B:) Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)

SCOPe Domain Sequences for d5cqbb_:

Sequence, based on SEQRES records: (download)

>d5cqbb_ c.101.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenw
nrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagnt
gltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirt
ggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafan

Sequence, based on observed residues (ATOM records): (download)

>d5cqbb_ c.101.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafelfvw
aldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdi
vqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiay
aelyftdvlwpdfdeqdfegalnafan

SCOPe Domain Coordinates for d5cqbb_:

Click to download the PDB-style file with coordinates for d5cqbb_.
(The format of our PDB-style files is described here.)

Timeline for d5cqbb_: