SCOPe 2.06: Domain d5by1b_: 5by1 B:

Lineage for d5by1b_ (5by1 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (6 species)
   not a true protein

7. Species Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11)) [TaxId:1395524] [276129] (1 PDB entry)

8. Domain d5by1b_: 5by1 B: [276131]
   automated match to d3m8ac_
   complexed with 1pe, peg

Details for d5by1b_

PDB Entry: 5by1, 1.75 Å

PDB Description: h18 bat influenza ns1 rna binding domain

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d5by1b_:

Sequence; same for both SEQRES and ATOM records:

>d5by1b_ a.16.1.1 (B:) automated matches {Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11)) [TaxId: 1395524]}
tpttiafqvdcylwhlkkmlslmgevdapfedrlrreqkalkgrsmtlgidiqaatkagy
ykiksitedam

Timeline for d5by1b_:

• d5by1b_ first appeared in SCOPe 2.05
  
• d5by1b_ appears in SCOPe 2.07
  
• d5by1b_ appears in the current release, SCOPe 2.08