SCOPe 2.07: Domain d4zzxb2: 4zzx B:365-583

Lineage for d4zzxb2 (4zzx B:365-583)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
   automatically mapped to Pfam PF00644

6. Protein automated matches [227023] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)

8. Domain d4zzxb2: 4zzx B:365-583 [276102]
   Other proteins in same PDB: d4zzxa1, d4zzxb1
   automated match to d1gs0a2
   complexed with fsu

Details for d4zzxb2

PDB Entry: 4zzx, 1.65 Å

PDB Description: structure of parp2 catalytic domain bound to an isoindolinone inhibitor

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4zzxb2:

Sequence; same for both SEQRES and ATOM records:

>d4zzxb2 d.166.1.2 (B:365-583) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriappeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnflqlw

Timeline for d4zzxb2:

• d4zzxb2 first appeared in SCOPe 2.05
  
• d4zzxb2 appears in SCOPe 2.06
  
• d4zzxb2 appears in the current release, SCOPe 2.08