SCOPe 2.07: Domain d4zzxa1: 4zzx A:231-364

Lineage for d4zzxa1 (4zzx A:231-364)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)

8. Domain d4zzxa1: 4zzx A:231-364 [276099]
   Other proteins in same PDB: d4zzxa2, d4zzxb2
   automated match to d1gs0a1
   complexed with fsu

Details for d4zzxa1

PDB Entry: 4zzx, 1.65 Å

PDB Description: structure of parp2 catalytic domain bound to an isoindolinone inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4zzxa1:

Sequence; same for both SEQRES and ATOM records:

>d4zzxa1 a.41.1.0 (A:231-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esqldlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedcir
agqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkte
lqspehpldqhyrn

Timeline for d4zzxa1:

• d4zzxa1 first appeared in SCOPe 2.05
  
• d4zzxa1 appears in SCOPe 2.06
  
• d4zzxa1 appears in the current release, SCOPe 2.08