Lineage for d4zzya2 (4zzy A:365-583)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234080Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2234104Protein automated matches [227023] (1 species)
    not a true protein
  7. 2234105Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries)
  8. 2234114Domain d4zzya2: 4zzy A:365-583 [276096]
    Other proteins in same PDB: d4zzya1
    automated match to d1gs0a2
    complexed with d7n

Details for d4zzya2

PDB Entry: 4zzy (more details), 2.2 Å

PDB Description: structure of human parp2 catalytic domain bound to an isoindolinone inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4zzya2:

Sequence, based on SEQRES records: (download)

>d4zzya2 d.166.1.2 (A:365-583) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriappeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnflqlw

Sequence, based on observed residues (ATOM records): (download)

>d4zzya2 d.166.1.2 (A:365-583) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriappeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilngytlnyneyivynpnqvrmryllkvqfnflqlw

SCOPe Domain Coordinates for d4zzya2:

Click to download the PDB-style file with coordinates for d4zzya2.
(The format of our PDB-style files is described here.)

Timeline for d4zzya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zzya1