Lineage for d4zzya1 (4zzy A:231-364)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325389Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2325390Protein automated matches [226964] (2 species)
    not a true protein
  7. 2325394Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2325466Domain d4zzya1: 4zzy A:231-364 [276095]
    Other proteins in same PDB: d4zzya2
    automated match to d1gs0a1
    complexed with d7n

Details for d4zzya1

PDB Entry: 4zzy (more details), 2.2 Å

PDB Description: structure of human parp2 catalytic domain bound to an isoindolinone inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4zzya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zzya1 a.41.1.0 (A:231-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esqldlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedcir
agqhgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkte
lqspehpldqhyrn

SCOPe Domain Coordinates for d4zzya1:

Click to download the PDB-style file with coordinates for d4zzya1.
(The format of our PDB-style files is described here.)

Timeline for d4zzya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zzya2