Lineage for d4y1qi_ (4y1q I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901437Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 1901438Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 1901456Family d.35.1.0: automated matches [196913] (1 protein)
    not a true family
  6. 1901457Protein automated matches [196914] (3 species)
    not a true protein
  7. 1901475Species Yersinia pseudotuberculosis [TaxId:273123] [276064] (3 PDB entries)
  8. 1901483Domain d4y1qi_: 4y1q I: [276073]
    automated match to d4jera_
    complexed with hem; mutant

Details for d4y1qi_

PDB Entry: 4y1q (more details), 3.1 Å

PDB Description: crystal structure of hasa mutant y75a monomer from yersinia pseudotuberculosis
PDB Compounds: (I:) Extracellular heme acquisition hemophore HasA

SCOPe Domain Sequences for d4y1qi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y1qi_ d.35.1.0 (I:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh
snpegmiaegdlkasfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl
sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd

SCOPe Domain Coordinates for d4y1qi_:

Click to download the PDB-style file with coordinates for d4y1qi_.
(The format of our PDB-style files is described here.)

Timeline for d4y1qi_: