Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) |
Family d.35.1.0: automated matches [196913] (1 protein) not a true family |
Protein automated matches [196914] (3 species) not a true protein |
Species Yersinia pseudotuberculosis [TaxId:273123] [276064] (3 PDB entries) |
Domain d4y1qi_: 4y1q I: [276073] automated match to d4jera_ complexed with hem; mutant |
PDB Entry: 4y1q (more details), 3.1 Å
SCOPe Domain Sequences for d4y1qi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y1qi_ d.35.1.0 (I:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]} sttiqynsnyadysissylrewannfgdidqapaetkdrgsfsgsstlfsgtqyaigssh snpegmiaegdlkasfmpqhtfhgqidtlqfgkdlatnaggpsagkhlekiditfneldl sgefdsgksmtenhqgdmhksvrglmkgnpdpmlevmkakginvdtafkdlsiasqypd
Timeline for d4y1qi_: