SCOPe 2.05: Domain d4uu9l_: 4uu9 L:

Lineage for d4uu9l_ (4uu9 L:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4uu9l_: 4uu9 L: [276042]
   Other proteins in same PDB: d4uu9a_, d4uu9c_, d4uu9d_, d4uu9h_
   automated match to d3lrga_
   complexed with so4

Details for d4uu9l_

PDB Entry: 4uu9, 2.12 Å

PDB Description: crystal structure of the human c5a in complex with medi7814 a neutralising antibody

PDB Compounds: (L:) medi7814

SCOPe Domain Sequences for d4uu9l_:

Sequence; same for both SEQRES and ATOM records:

>d4uu9l_ b.1.1.0 (L:) automated matches {Homo sapiens [TaxId: 9606]}
qsaltqpasvsgspgqsitisctgtssdiggskyvswyqqhpgkapkliifdvnrrpsgl
snrfsasksgntasltisglqaedeadyyctsyhptktilfgggtkltvl

Timeline for d4uu9l_:

• d4uu9l_ is new in SCOPe 2.05-stable
  
• d4uu9l_ appears in SCOPe 2.06
  
• d4uu9l_ appears in the current release, SCOPe 2.08