Lineage for d1ivb__ (1ivb -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.68: 6-bladed beta-propeller [50938] (7 superfamilies) Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) 
Family b.68.1.1: Sialidases (neuraminidases) [50940] (6 proteins) 
Protein Influenza neuraminidase [50943] (2 species) 
Species Influenza B virus, different strains [TaxId:11520] [50945] (11 PDB entries) 
Domain d1ivb__: 1ivb - [27604]
Details for d1ivb__
PDB Entry: 1ivb (more details), 2.4 Å
PDB Description: structures of aromatic inhibitors of influenza virus neuraminidase
SCOP Domain Sequences for d1ivb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivb__ b.68.1.1 (-) Influenza neuraminidase {Influenza B virus, different strains}
epewtyprlscqgstfqkallisphrfgeikgnsapliirepfvacgpkecrhfalthya
aqpggyyngtrkdrnklrhlvsvklgkiptvensifhmaawsgsachdgrewtyigvdgp
dndalvkikygeaytdtyhsyahnilrtqesacnciggdcylmitdgsasgiskcrflki
regriikeilptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirl
mctktyldtprpddgsiagpcesngdkwlggikggfvhqrmaskigrwysrtmsktnrmg
melyvrydgdpwtdsdaltlsgvmvsieepgwysfgfeikdkkcdvpcigiemvhdggkd
twhsaataiyclmgsgqllwdtvtgvdmal
SCOP Domain Coordinates for d1ivb__:
Click to download the PDB-style file with coordinates for d1ivb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ivb__:
- d1ivb__ first appeared (with stable ids) in SCOP 1.55
- d1ivb__ appears in SCOP 1.57
- d1ivb__ appears in SCOP 1.61
- d1ivb__ appears in the current release, SCOPe 2.08, called d1ivba_
View in 3D