SCOPe 2.05: Domain d4wigb_: 4wig B:

Lineage for d4wigb_ (4wig B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196473] (3 PDB entries)

8. Domain d4wigb_: 4wig B: [276039]
   automated match to d1r5tc_
   complexed with zn; mutant

Details for d4wigb_

PDB Entry: 4wig, 1.76 Å

PDB Description: crystal structure of e47d mutant cytidine deaminase from mycobacterium tuberculosis (mtcda e47d)

PDB Compounds: (B:) Cytidine deaminase

SCOPe Domain Sequences for d4wigb_:

Sequence; same for both SEQRES and ATOM records:

>d4wigb_ c.97.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvdwnmlrgnatqaaagayvpysrfavgaaalvddgrvvtgcnvdnvsygltlcaecavv
calhstgggrllalacvdghgsvlmpcgrcrqvllehggsellidhpvrprrlgdllpda
fglddl

Timeline for d4wigb_:

• d4wigb_ is new in SCOPe 2.05-stable
  
• d4wigb_ appears in SCOPe 2.06
  
• d4wigb_ appears in the current release, SCOPe 2.08