SCOPe 2.05: Domain d4uu9h_: 4uu9 H:

Lineage for d4uu9h_ (4uu9 H:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4uu9h_: 4uu9 H: [276037]
   Other proteins in same PDB: d4uu9b_, d4uu9c_, d4uu9d_, d4uu9l_
   automated match to d3zhka_
   complexed with so4

Details for d4uu9h_

PDB Entry: 4uu9, 2.12 Å

PDB Description: crystal structure of the human c5a in complex with medi7814 a neutralising antibody

PDB Compounds: (H:) medi7814

SCOPe Domain Sequences for d4uu9h_:

Sequence; same for both SEQRES and ATOM records:

>d4uu9h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfssyamswvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycardddyeewpwyygmdvwgqgtmv
tvs

Timeline for d4uu9h_:

• d4uu9h_ is new in SCOPe 2.05-stable
  
• d4uu9h_ appears in SCOPe 2.06
  
• d4uu9h_ appears in the current release, SCOPe 2.08