Lineage for d4uu9d1 (4uu9 D:1-65)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000477Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2000478Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2000479Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2000497Protein automated matches [257397] (2 species)
    not a true protein
  7. 2000498Species Human (Homo sapiens) [TaxId:9606] [276021] (1 PDB entry)
  8. 2000500Domain d4uu9d1: 4uu9 D:1-65 [276023]
    Other proteins in same PDB: d4uu9a_, d4uu9b_, d4uu9c2, d4uu9d2, d4uu9h_, d4uu9l_
    automated match to d1kjsa_
    complexed with so4

Details for d4uu9d1

PDB Entry: 4uu9 (more details), 2.12 Å

PDB Description: crystal structure of the human c5a in complex with medi7814 a neutralising antibody
PDB Compounds: (D:) Complement C5

SCOPe Domain Sequences for d4uu9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu9d1 a.50.1.1 (D:1-65) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lrani

SCOPe Domain Coordinates for d4uu9d1:

Click to download the PDB-style file with coordinates for d4uu9d1.
(The format of our PDB-style files is described here.)

Timeline for d4uu9d1: