Class a: All alpha proteins [46456] (289 folds) |
Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) |
Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
Protein automated matches [257397] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [276021] (1 PDB entry) |
Domain d4uu9d1: 4uu9 D:1-65 [276023] Other proteins in same PDB: d4uu9a_, d4uu9b_, d4uu9c2, d4uu9d2, d4uu9h_, d4uu9l_ automated match to d1kjsa_ complexed with so4 |
PDB Entry: 4uu9 (more details), 2.12 Å
SCOPe Domain Sequences for d4uu9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uu9d1 a.50.1.1 (D:1-65) automated matches {Human (Homo sapiens) [TaxId: 9606]} tlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq lrani
Timeline for d4uu9d1: