Lineage for d4uuoa2 (4uuo A:154-336)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939432Species Trichomonas vaginalis [TaxId:5722] [276012] (4 PDB entries)
  8. 1939439Domain d4uuoa2: 4uuo A:154-336 [276018]
    Other proteins in same PDB: d4uuoa1
    automated match to d1bdma2

Details for d4uuoa2

PDB Entry: 4uuo (more details), 2.58 Å

PDB Description: apo trichomonas vaginalis malate dehydrogenase
PDB Compounds: (A:) cytosolic malate dehydrogenase

SCOPe Domain Sequences for d4uuoa2:

Sequence, based on SEQRES records: (download)

>d4uuoa2 d.162.1.0 (A:154-336) automated matches {Trichomonas vaginalis [TaxId: 5722]}
trldhnrmvgalaakfgvtpekihkvciwgnhsntqvpdtthatvdlpegtvkvadklpk
eylegefaqmiatrggavikmrgassaasaanaaltcvkdwlygtaegdfvsmaipvpdn
epygikqgtifsfpvtvskdgevhvveglelndwvkgrleatekeligeketawkvlgll
ehh

Sequence, based on observed residues (ATOM records): (download)

>d4uuoa2 d.162.1.0 (A:154-336) automated matches {Trichomonas vaginalis [TaxId: 5722]}
trldhnrmvgalaakfgvtpekihkvciwgnhsntqvpdtthatvdtvkvadklpkeyle
gefaqmiatrggavikmrgassaasaanaaltcvkdwlygtdfvsmaipvpdnepygikq
gtifsfpvtvskdgevhvveglelndwvkgrleatekeligeketawkvlgllehh

SCOPe Domain Coordinates for d4uuoa2:

Click to download the PDB-style file with coordinates for d4uuoa2.
(The format of our PDB-style files is described here.)

Timeline for d4uuoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uuoa1