Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Trichomonas vaginalis [TaxId:5722] [276010] (5 PDB entries) |
Domain d4uumb1: 4uum B:2-154 [276014] Other proteins in same PDB: d4uuma2, d4uuma3, d4uumb2, d4uumb3 automated match to d5mdha1 |
PDB Entry: 4uum (more details), 1.37 Å
SCOPe Domain Sequences for d4uumb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uumb1 c.2.1.0 (B:2-154) automated matches {Trichomonas vaginalis [TaxId: 5722]} seaahvlitgaagqigyilshwiasgelygdrqvylhlldippamnrltaltmeledcaf phlagfvattdpkaafkdidcaflvasmplkpgqvradlissnsvifkntgeylskwakp svkvlvignpdntnceiamlhaknlkpenfssl
Timeline for d4uumb1: