Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) |
Domain d4uj3a_: 4uj3 A: [276004] Other proteins in same PDB: d4uj3f_, d4uj3i_, d4uj3l_, d4uj3o_, d4uj3r_, d4uj3u_ automated match to d2bmda1 complexed with gnp, mg, pg4, so4 |
PDB Entry: 4uj3 (more details), 3 Å
SCOPe Domain Sequences for d4uj3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uj3a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq iwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvg nksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
Timeline for d4uj3a_: