Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) |
Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins) contains PfamB PB042332, PfamB PB026102 |
Protein automated matches [275997] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [275998] (1 PDB entry) |
Domain d4uj3f_: 4uj3 F: [275999] Other proteins in same PDB: d4uj3a_, d4uj3d_, d4uj3g_, d4uj3j_, d4uj3m_, d4uj3p_, d4uj3s_, d4uj3v_ automated match to d2hv8e_ complexed with gnp, mg, pg4, so4 |
PDB Entry: 4uj3 (more details), 3 Å
SCOPe Domain Sequences for d4uj3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uj3f_ h.1.31.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lmeaiqkqeeinfrlqdyidriivaimetnpsilevk
Timeline for d4uj3f_: