SCOPe 2.05: Domain d4u88b_: 4u88 B:

Lineage for d4u88b_ (4u88 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (14 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1458279] [275992] (1 PDB entry)

8. Domain d4u88b_: 4u88 B: [275994]
   automated match to d4ixaa_

Details for d4u88b_

PDB Entry: 4u88, 2.36 Å

PDB Description: structure of the dna-binding domain of the response regulator saer from staphylococcus aureus

PDB Compounds: (B:) Transcriptional regulator SaeR

SCOPe Domain Sequences for d4u88b_:

Sequence; same for both SEQRES and ATOM records:

>d4u88b_ a.4.6.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1458279]}
eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
edantvnvhihrireklekesfttytittvwglgykfer

Timeline for d4u88b_:

• d4u88b_ is new in SCOPe 2.05-stable
  
• d4u88b_ appears in SCOPe 2.06
  
• d4u88b_ appears in the current release, SCOPe 2.08