Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries) |
Domain d4rirb1: 4rir B:1-107 [275988] Other proteins in same PDB: d4rirb2, d4rirl2 automated match to d1lila1 |
PDB Entry: 4rir (more details), 2.5 Å
SCOPe Domain Sequences for d4rirb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rirb1 b.1.1.0 (B:1-107) automated matches {Homo sapiens [TaxId: 9606]} nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp drfsgsidsssnsasltisglktedeadyycqsydssswvfgggtkltvlg
Timeline for d4rirb1: