Lineage for d4qy5a_ (4qy5 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013927Species Pseudomonas aeruginosa [TaxId:287] [225853] (6 PDB entries)
  8. 3013932Domain d4qy5a_: 4qy5 A: [275953]
    automated match to d4id4a_
    complexed with cl, mg

Details for d4qy5a_

PDB Entry: 4qy5 (more details), 1.5 Å

PDB Description: crystal structures of chimeric beta-lactamase ctem-19m showing different conformations
PDB Compounds: (A:) Beta-lactamase TEM,Beta-lactamase PSE-4

SCOPe Domain Sequences for d4qy5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qy5a_ e.3.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpltstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltdflrqigdketrldriepdlnegklgdlrdtttpkaiastlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d4qy5a_:

Click to download the PDB-style file with coordinates for d4qy5a_.
(The format of our PDB-style files is described here.)

Timeline for d4qy5a_: