SCOPe 2.05: Domain d4r1od2: 4r1o D:328-497

Lineage for d4r1od2 (4r1o D:328-497)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families)

5. Family b.43.2.0: automated matches [227252] (1 protein)
   not a true family

6. Protein automated matches [227032] (4 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:235909] [275932] (3 PDB entries)

8. Domain d4r1od2: 4r1o D:328-497 [275939]
   Other proteins in same PDB: d4r1oa1, d4r1ob1, d4r1oc1, d4r1od1, d4r1oe1, d4r1of1
   automated match to d2ajta1

Details for d4r1od2

PDB Entry: 4r1o, 2.4 Å

PDB Description: crystal structure of thermophilic geobacillus kaustophilus l-arabinose isomerase

PDB Compounds: (D:) L-arabinose isomerase

SCOPe Domain Sequences for d4r1od2:

Sequence; same for both SEQRES and ATOM records:

>d4r1od2 b.43.2.0 (D:328-497) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
tsfmedytyhfepgnelilgahmlevcptiaatrprvevhplsiggkedparlvfdggeg
aavnaslidlghrfrlivnevdavkpehdmpklpvarilwkprpslrdsaeawilaggah
htcfsfavtteqlqdfaemagiecvvinehtsvssfknelkwnevfwrgr

Timeline for d4r1od2:

• d4r1od2 is new in SCOPe 2.05-stable
  
• d4r1od2 appears in SCOPe 2.06
  
• d4r1od2 appears in the current release, SCOPe 2.08