SCOPe 2.05: Domain d4n1ma_: 4n1m A:

Lineage for d4n1ma_ (4n1m A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186915] (15 PDB entries)

8. Domain d4n1ma_: 4n1m A: [275914]
   automated match to d3o7ta_
   complexed with gly, pro

Details for d4n1ma_

PDB Entry: 4n1m, 1.15 Å

PDB Description: structure of cyclophilin a in complex with glypro.

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d4n1ma_:

Sequence; same for both SEQRES and ATOM records:

>d4n1ma_ b.62.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmmvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhrii
pgfmcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqfficta
ktewldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d4n1ma_:

• d4n1ma_ is new in SCOPe 2.05-stable
  
• d4n1ma_ is called d4n1ma1 in SCOPe 2.06
  
• d4n1ma_ appears in the current release, SCOPe 2.08, called d4n1ma1