SCOPe 2.07: Domain d5czga1: 5czg A:1-114

Lineage for d5czga1 (5czg A:1-114)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries)

8. Domain d5czga1: 5czg A:1-114 [275908]
   Other proteins in same PDB: d5czga2
   automated match to d4nrba_
   complexed with bmf, na, unx

Details for d5czga1

PDB Entry: 5czg, 1.45 Å

PDB Description: crystal structure analysis of hypothetical bromodomain tb427.10.7420 from trypanosoma brucei in complex with bromosporine

PDB Compounds: (A:) Hypothetical Bromodomain

SCOPe Domain Sequences for d5czga1:

Sequence; same for both SEQRES and ATOM records:

>d5czga1 a.29.2.0 (A:1-114) automated matches {Trypanosoma brucei [TaxId: 679716]}
msknerdtsfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgi
ekgtyatdvdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv

Timeline for d5czga1:

• d5czga1 first appeared in SCOPe 2.05, called d5czga_
  
• d5czga1 appears in SCOPe 2.06
  
• d5czga1 appears in the current release, SCOPe 2.08